Ferritin Light Chain Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23407225UL

Catalog No. NB436648

Description

Ferritin Light Chain Polyclonal specifically detects Ferritin Light Chain in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Ferritin Light Chain
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: P02792
• Gene Symbols: FTL
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTD
• Quantity: 25 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 2512
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Ferritin L subunit, ferritin L-chain, ferritin light chain, ferritin light polypeptide-like 3, ferritin, light polypeptide, MGC71996, NBIA3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only