Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FGF-4 Antibody, Novus Biologicals™

FGF-4 Antibody, Novus Biologicals™
SDP

Catalog No. NB433056 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB433056 25 μL
NBP183291 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB433056 Supplier Novus Biologicals Supplier No. NBP18329125UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

FGF-4 Polyclonal specifically detects FGF-4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen FGF-4
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias fibroblast growth factor 4, HBGF-4Transforming protein KS3, heparin secretory transforming protein 1, Heparin secretory-transforming protein 1, Heparin-binding growth factor 4, HST-1HSTF-1, HSTF1fibroblast growth factor 4 splice isoform, HSTFGF-4, human stomach cancer, transforming factor from FGF-related oncogene, kaposi sarcoma oncogene, KFGF, K-FGF, KS3, oncogene HST
Gene Symbols FGF4
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFL
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Angiogenesis, Cancer
Primary or Secondary Primary
Gene ID (Entrez) 2249
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.