FGF-8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198443

Catalog No. NBP198443

Description

FGF-8 Polyclonal specifically detects FGF-8 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: FGF-8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AIGFKAL6, Androgen-induced growth factor, FGF-8, fibroblast growth factor 8, fibroblast growth factor 8 (androgen-induced), HBGF-8, Heparin-binding growth factor 8, MGC149376
• Host Species: Rabbit
• Molecular Weight of Antigen: 24 kDa
• Quantity: 100 μL
• Research Discipline: Angiogenesis, Cell Cycle and Replication
• Gene ID (Entrez): 2253
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_149354
• Gene Symbols: FGF8
• Immunogen: The immunogen for this antibody is FGF8 - middle region. Peptide sequence LIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG