Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FGF14 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16900620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16900620 20 μL
NBP169006 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16900620 Supplier Novus Biologicals Supplier No. NBP16900620UL

Rabbit Polyclonal Antibody

FGF14 Polyclonal specifically detects FGF14 in Human samples. It is validated for Western Blot.

Specifications

Antigen FGF14
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q92915
Gene Alias bA397O8.2, FGF-14, FHF4FHF-4, fibroblast growth factor 14, Fibroblast growth factor homologous factor 4, SCA27MGC119129
Gene Symbols FGF14
Host Species Rabbit
Immunogen Synthetic peptides corresponding to FGF14 (fibroblast growth factor 14) The peptide sequence was selected from the middle region of FGF14. Peptide sequence ENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKP.
Molecular Weight of Antigen 28 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Angiogenesis, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 2259
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.