Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FGF14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | FGF14 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16900620
|
Novus Biologicals
NBP16900620UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP169006
|
Novus Biologicals
NBP169006 |
100 μL |
Each for $487.50
|
|
|||||
Description
FGF14 Polyclonal specifically detects FGF14 in Human samples. It is validated for Western Blot.Specifications
| FGF14 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis, Neuroscience | |
| bA397O8.2, FGF-14, FHF4FHF-4, fibroblast growth factor 14, Fibroblast growth factor homologous factor 4, SCA27MGC119129 | |
| FGF14 | |
| IgG | |
| 28 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q92915 | |
| 2259 | |
| Synthetic peptides corresponding to FGF14 (fibroblast growth factor 14) The peptide sequence was selected from the middle region of FGF14. Peptide sequence ENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKP. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title