FGFR1 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP233784	0.1 mL
NB436755	25 μL

Catalog No. NBP233784 Supplier Novus Biologicals Supplier No. NBP233784

Description

Rabbit Polyclonal Antibody

FGFR1 Polyclonal specifically detects FGFR1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FGFR1
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Accession No.: P11362
• Gene Alias: basic fibroblast growth factor receptor 1, BFGFR, bFGF-R-1, CD331, CD331 antigen, CEK, EC 2.7.10, EC 2.7.10.1, FGFBR, FGFR-1, fibroblast growth factor receptor 1, FLGH3, FLJ99988, FLT-2, FLT2H4, Fms-like tyrosine kinase 2, fms-related tyrosine kinase 2, H2, H5, HBGFR, heparin-binding growth factor receptor, hydroxyaryl-protein kinase, KAL 2, KAL2, N-SAM, OGD, Proto-oncogene c-Fgr, soluble FGFR1 variant 1, soluble FGFR1 variant 2
• Gene Symbols: FGFR1
• Host Species: Rabbit
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTR
• Purification Method: Affinity Purified
• Quantity: 0.1 mL
• Regulatory Status: RUO
• Research Discipline: Angiogenesis, Apoptosis, Core ESC Like Genes, Protein Kinase, Signal Transduction, Stem Cell Markers
• Primary or Secondary: Primary
• Gene ID (Entrez): 2260
• Test Specificity: Specificity of human FGFR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only