Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FGFR1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP233784 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP233784 0.1 mL
NB436755 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP233784 Supplier Novus Biologicals Supplier No. NBP233784
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

FGFR1 Polyclonal specifically detects FGFR1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen FGFR1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P11362
Gene Alias basic fibroblast growth factor receptor 1, BFGFR, bFGF-R-1, CD331, CD331 antigen, CEK, EC 2.7.10, EC 2.7.10.1, FGFBR, FGFR-1, fibroblast growth factor receptor 1, FLGH3, FLJ99988, FLT-2, FLT2H4, Fms-like tyrosine kinase 2, fms-related tyrosine kinase 2, H2, H5, HBGFR, heparin-binding growth factor receptor, hydroxyaryl-protein kinase, KAL 2, KAL2, N-SAM, OGD, Proto-oncogene c-Fgr, soluble FGFR1 variant 1, soluble FGFR1 variant 2
Gene Symbols FGFR1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTR
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Angiogenesis, Apoptosis, Core ESC Like Genes, Protein Kinase, Signal Transduction, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 2260
Test Specificity Specificity of human FGFR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.