Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FGFR1OP Antibody, Novus Biologicals™

FGFR1OP Antibody, Novus Biologicals™
SDP

Catalog No. NB393710 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB393710 25 μL
NBP257930 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB393710 Supplier Novus Biologicals Supplier No. NBP25793025UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

FGFR1OP Polyclonal specifically detects FGFR1OP in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen FGFR1OP
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene Alias FGFR1 oncogene partner, FOPfibroblast growth factor receptor 1 oncogene partner
Gene Symbols CEP43
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVL
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Angiogenesis, Apoptosis, Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 11116
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.