Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FGL2/Fibroleukin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15696520UL
Description
FGL2/Fibroleukin Polyclonal specifically detects FGL2/Fibroleukin in Human samples. It is validated for Western Blot.Specifications
FGL2/Fibroleukin | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q14314 | |
FGL2 | |
Synthetic peptides corresponding to FGL2 (fibrinogen-like 2) The peptide sequence was selected from the middle region of FGL2. Peptide sequence WTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL. | |
20 μL | |
Cancer | |
10875 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
fibrinogen-like 2, Fibrinogen-like protein 2, fibroleukin, pT49T49 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction