Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FGL2/Fibroleukin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	FGL2/Fibroleukin
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15696520 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15696520UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP156965 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP156965	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

FGL2/Fibroleukin Polyclonal specifically detects FGL2/Fibroleukin in Human samples. It is validated for Western Blot.

Specifications

Antigen	FGL2/Fibroleukin
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cancer
Gene Alias	fibrinogen-like 2, Fibrinogen-like protein 2, fibroleukin, pT49T49
Gene Symbols	FGL2
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q14314
Gene ID (Entrez)	10875
Immunogen	Synthetic peptides corresponding to FGL2 (fibrinogen-like 2) The peptide sequence was selected from the middle region of FGL2. Peptide sequence WTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

FGL2/Fibroleukin Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents