FIH-1/HIF-1AN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25474925UL

Catalog No. NB395270

Description

FIH-1/HIF-1AN Polyclonal specifically detects FIH-1/HIF-1AN in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FIH-1/HIF-1AN
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: DKFZp762F1811, EC 1.14.11.16, factor inhibiting HIF1, Factor inhibiting HIF-1, FIH1FIH-1, FLJ20615, FLJ22027, hypoxia inducible factor 1, alpha subunit inhibitor, hypoxia-inducible factor 1-alpha inhibitor, Hypoxia-inducible factor asparagine hydroxylase, peptide-aspartate beta-dioxygenase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: HIF1AN
• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:YLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKI
• Quantity: 25 μL
• Research Discipline: Angiogenesis, Cancer, Chromatin Research, Hypoxia, Transcription Factors and Regulators
• Gene ID (Entrez): 55662
• Target Species: Human
• Isotype: IgG

For Research Use Only