Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FIH-1/HIF-1AN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP254749
Description
FIH-1/HIF-1AN Polyclonal specifically detects FIH-1/HIF-1AN in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
FIH-1/HIF-1AN | |
Polyclonal | |
Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
DKFZp762F1811, EC 1.14.11.16, factor inhibiting HIF1, Factor inhibiting HIF-1, FIH1FIH-1, FLJ20615, FLJ22027, hypoxia inducible factor 1, alpha subunit inhibitor, hypoxia-inducible factor 1-alpha inhibitor, Hypoxia-inducible factor asparagine hydroxylase, peptide-aspartate beta-dioxygenase | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
HIF1AN | |
This antibody was developed against a Recombinant Protein corresponding to amino acids:YLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKI | |
100 μL | |
Angiogenesis, Cancer, Chromatin Research, Hypoxia, Transcription Factors and Regulators | |
55662 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction