Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FIH-1/HIF-1AN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | FIH-1/HIF-1AN |
---|---|
Dilution | Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Applications | Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
FIH-1/HIF-1AN Polyclonal specifically detects FIH-1/HIF-1AN in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
FIH-1/HIF-1AN | |
Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
DKFZp762F1811, EC 1.14.11.16, factor inhibiting HIF1, Factor inhibiting HIF-1, FIH1FIH-1, FLJ20615, FLJ22027, hypoxia inducible factor 1, alpha subunit inhibitor, hypoxia-inducible factor 1-alpha inhibitor, Hypoxia-inducible factor asparagine hydroxylase, peptide-aspartate beta-dioxygenase | |
HIF1AN | |
IgG | |
Affinity Purified |
Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Rabbit | |
Angiogenesis, Cancer, Chromatin Research, Hypoxia, Transcription Factors and Regulators | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
55662 | |
This antibody was developed against a Recombinant Protein corresponding to amino acids:YLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKI | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title