FKBP10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24924225UL

Catalog No. NB395786

Description

FKBP10 Polyclonal antibody specifically detects FKBP10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: FKBP10
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Gene Alias: 65 kDa FK506-binding protein, 65 kDa FKBP, EC 5.2.1.8, FK506 binding protein 10 (65 kDa), FK506 binding protein 10, 65 kDa, FK506-binding protein 10, FKBP-10, FKBP6, FKBP-65, FKBP65PPIase FKBP10, FLJ20683, FLJ22041, FLJ23833, hFKBP65, Immunophilin FKBP65, OI6, peptidyl-prolyl cis-trans isomerase FKBP10, PPIASE, Rotamase
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GLPTGYLFVWHKDPPANLFEDMDLNKDGEVPPEEFSTFIKAQVSEGKGRLMPGQDPEKTIGDMFQNQDRNQDGKITV
• Quantity: 25 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 60681
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG