Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FKBP10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | FKBP10 |
---|---|
Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
FKBP10 Polyclonal antibody specifically detects FKBP10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
FKBP10 | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Human | |
65 kDa FK506-binding protein, 65 kDa FKBP, EC 5.2.1.8, FK506 binding protein 10 (65 kDa), FK506 binding protein 10, 65 kDa, FK506-binding protein 10, FKBP-10, FKBP6, FKBP-65, FKBP65PPIase FKBP10, FLJ20683, FLJ22041, FLJ23833, hFKBP65, Immunophilin FKBP65, OI6, peptidyl-prolyl cis-trans isomerase FKBP10, PPIASE, Rotamase | |
This antibody was developed against a recombinant protein corresponding to amino acids: GLPTGYLFVWHKDPPANLFEDMDLNKDGEVPPEEFSTFIKAQVSEGKGRLMPGQDPEKTIGDMFQNQDRNQDGKITV | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
Polyclonal | |
Purified | |
RUO | |
PBS (pH 7.2), 40% Glycerol | |
60681 | |
IgG | |
Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title