FKBP14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP183890

Catalog No. NBP183890

Description

FKBP14 Polyclonal specifically detects FKBP14 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FKBP14
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: 22 kDa FK506-binding protein, EC 5.2.1.8, FK506 binding protein 14 (22 kDa), FK506 binding protein 14, 22 kDa, FK506-binding protein 14, FKBP-14, FKBP-22, FKBP22PPIase FKBP14, FLJ20731, peptidyl-prolyl cis-trans isomerase FKBP14,22 kDa FKBP, rotamase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: FKBP14
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVE
• Quantity: 0.1 mL
• Research Discipline: Developmental Biology
• Gene ID (Entrez): 55033
• Target Species: Human
• Isotype: IgG

For Research Use Only