Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FKBP25 Antibody, Novus Biologicals™

FKBP25 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15435420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15435420 20 μL
NBP154354 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15435420 Supplier Novus Biologicals Supplier No. NBP15435420UL

Description

Rabbit Polyclonal Antibody

FKBP25 Polyclonal specifically detects FKBP25 in Human samples. It is validated for Western Blot.

Specifications

Antigen FKBP25
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q00688
Gene Alias EC 5.2.1.8,25 kDa FK506-binding protein, FK506 binding protein 3, 25kDa, FK506-binding protein 3, FK506-binding protein 3 (25kD), FKBP25,25 kDa FKBP, FKBP-3, Immunophilin FKBP25, peptidyl-prolyl cis-trans isomerase FKBP3, PPIase, PPIase FKBP3, rapamycin binding protein, Rapamycin-selective 25 kDa immunophilin, Rotamase, T-cell
Gene Symbols FKBP3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to FKBP3(FK506 binding protein 3, 25kDa) The peptide sequence was selected from the C terminal of FKBP3. Peptide sequence EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID.
Molecular Weight of Antigen 25 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 2287
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.