Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FKBP25 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | FKBP25 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP154354
![]() |
Novus Biologicals
NBP154354 |
100 μL |
Each for $480.74
|
|
|||||
NBP15435420
![]() |
Novus Biologicals
NBP15435420UL |
20 μL | N/A | N/A | N/A | ||||
Description
FKBP25 Polyclonal specifically detects FKBP25 in Human samples. It is validated for Western Blot.Specifications
| FKBP25 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| EC 5.2.1.8,25 kDa FK506-binding protein, FK506 binding protein 3, 25kDa, FK506-binding protein 3, FK506-binding protein 3 (25kD), FKBP25,25 kDa FKBP, FKBP-3, Immunophilin FKBP25, peptidyl-prolyl cis-trans isomerase FKBP3, PPIase, PPIase FKBP3, rapamycin binding protein, Rapamycin-selective 25 kDa immunophilin, Rotamase, T-cell | |
| FKBP3 | |
| IgG | |
| 25 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q00688 | |
| 2287 | |
| Synthetic peptides corresponding to FKBP3(FK506 binding protein 3, 25kDa) The peptide sequence was selected from the C terminal of FKBP3. Peptide sequence EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title