Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FKBP25 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154354

 View more versions of this product

Catalog No. NBP154354


Add to cart

Description

Description

FKBP25 Polyclonal antibody specifically detects FKBP25 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

FKBP25
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
FKBP3
Synthetic peptides corresponding to FKBP3(FK506 binding protein 3, 25kDa) The peptide sequence was selected from the C terminal of FKBP3. Peptide sequence EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID.
25 kDa
100 ul
Stem Cell Markers
Primary
2287
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Western Blot
Western Blot 1:100-1:2000
Q00688
EC 5.2.1.8,25 kDa FK506-binding protein, FK506 binding protein 3, 25kDa, FK506-binding protein 3, FK506-binding protein 3 (25kD), FKBP25,25 kDa FKBP, FKBP-3, Immunophilin FKBP25, peptidyl-prolyl cis-trans isomerase FKBP3, PPIase, PPIase FKBP3, rapamycin binding protein, Rapamycin-selective 25 kDa immunophilin, Rotamase, T-cell
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit