FKBP25 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154354

Catalog No. NBP154354

Description

FKBP25 Polyclonal specifically detects FKBP25 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FKBP25
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 5.2.1.8,25 kDa FK506-binding protein, FK506 binding protein 3, 25kDa, FK506-binding protein 3, FK506-binding protein 3 (25kD), FKBP25,25 kDa FKBP, FKBP-3, Immunophilin FKBP25, peptidyl-prolyl cis-trans isomerase FKBP3, PPIase, PPIase FKBP3, rapamycin binding protein, Rapamycin-selective 25 kDa immunophilin, Rotamase, T-cell
• Host Species: Rabbit
• Molecular Weight of Antigen: 25 kDa
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 2287
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q00688
• Gene Symbols: FKBP3
• Immunogen: Synthetic peptides corresponding to FKBP3(FK506 binding protein 3, 25kDa) The peptide sequence was selected from the C terminal of FKBP3. Peptide sequence EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.