Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP233440

FKBP38 Antibody, Novus Biologicals™
SDP

Catalog No. NBP233440 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP233440 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP233440 Supplier Novus Biologicals Supplier No. NBP233440

Description

Rabbit Polyclonal Antibody

FKBP38 Polyclonal specifically detects FKBP38 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen FKBP38
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q14318
Gene Alias 38 kDa FK506-binding protein, EC 5.2.1.8,38 kDa FKBP, FK506 binding protein 8, 38kDa, FK506-binding protein 8, FK506-binding protein 8 (38kD), FKBP-38, FKBP38PPIase FKBP8, FKBP-8, FKBPr38, hFKBP38, peptidyl-prolyl cis-trans isomerase FKBP8, rotamase
Gene Symbols FKBP8
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: YDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGK
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Angiogenesis, Apoptosis, Astrocyte Markers, Cancer, Cellular Markers, Core ESC Like Genes, Glia Markers, Growth and Development, Mitotic Regulators, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Signal Transduction, Stem Cell Markers, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 23770
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.