FKBP38 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159018

Catalog No. NBP159018

Description

FKBP38 Polyclonal specifically detects FKBP38 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FKBP38
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 38 kDa FK506-binding protein, EC 5.2.1.8,38 kDa FKBP, FK506 binding protein 8, 38kDa, FK506-binding protein 8, FK506-binding protein 8 (38kD), FKBP-38, FKBP38PPIase FKBP8, FKBP-8, FKBPr38, hFKBP38, peptidyl-prolyl cis-trans isomerase FKBP8, rotamase
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Bovine: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: Q14318
• Gene Symbols: FKBP8
• Immunogen: Synthetic peptides corresponding to FKBP8(FK506 binding protein 8, 38kDa) The peptide sequence was selected from the N terminal of FKBP8. Peptide sequence GPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLS.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 23770
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.