Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FKBP38 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159018
Description
FKBP38 Polyclonal specifically detects FKBP38 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
FKBP38 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
38 kDa FK506-binding protein, EC 5.2.1.8,38 kDa FKBP, FK506 binding protein 8, 38kDa, FK506-binding protein 8, FK506-binding protein 8 (38kD), FKBP-38, FKBP38PPIase FKBP8, FKBP-8, FKBPr38, hFKBP38, peptidyl-prolyl cis-trans isomerase FKBP8, rotamase | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Bovine: 92%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
Q14318 | |
FKBP8 | |
Synthetic peptides corresponding to FKBP8(FK506 binding protein 8, 38kDa) The peptide sequence was selected from the N terminal of FKBP8. Peptide sequence GPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLS. | |
100 μL | |
Signal Transduction | |
23770 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction