Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FKBP38 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FKBP38 |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Description
FKBP38 Polyclonal specifically detects FKBP38 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
FKBP38 | |
Unconjugated | |
RUO | |
Q14318 | |
23770 | |
Synthetic peptides corresponding to FKBP8(FK506 binding protein 8, 38kDa) The peptide sequence was selected from the N terminal of FKBP8. Peptide sequence GPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLS. | |
Primary |
Polyclonal | |
Rabbit | |
Signal Transduction | |
38 kDa FK506-binding protein, EC 5.2.1.8,38 kDa FKBP, FK506 binding protein 8, 38kDa, FK506-binding protein 8, FK506-binding protein 8 (38kD), FKBP-38, FKBP38PPIase FKBP8, FKBP-8, FKBPr38, hFKBP38, peptidyl-prolyl cis-trans isomerase FKBP8, rotamase | |
FKBP8 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title