Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FKBP52/FKBP4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP256131
Description
FKBP52/FKBP4 Polyclonal specifically detects FKBP52/FKBP4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
FKBP52/FKBP4 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
51 kDa FK506-binding protein, 52 kDa FKBP, 59 kDa immunophilin, EC 5.2.1.8, FK506 binding protein 4, 59kDa, FK506-binding protein 4, FK506-binding protein 4 (59kD), FKBP-4, FKBP51, FKBP-52, FKBP52T-cell FK506-binding protein, 59kD, FKBP5952 kDa FK506-binding protein, HBI, HSP binding immunophilin, Hsp56, HSP-binding immunophilin, Immunophilin FKBP52, p52, p59, peptidylprolyl cis-trans isomerase, peptidyl-prolyl cis-trans isomerase FKBP4, PPIase, PPIase FKBP4, Rotamase | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
FKBP4 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVE | |
100 μL | |
Membrane Trafficking and Chaperones, Stem Cell Markers | |
2288 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction