FKBP52/FKBP4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256131

Catalog No. NBP256131

Description

FKBP52/FKBP4 Polyclonal specifically detects FKBP52/FKBP4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: FKBP52/FKBP4
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: 51 kDa FK506-binding protein, 52 kDa FKBP, 59 kDa immunophilin, EC 5.2.1.8, FK506 binding protein 4, 59kDa, FK506-binding protein 4, FK506-binding protein 4 (59kD), FKBP-4, FKBP51, FKBP-52, FKBP52T-cell FK506-binding protein, 59kD, FKBP5952 kDa FK506-binding protein, HBI, HSP binding immunophilin, Hsp56, HSP-binding immunophilin, Immunophilin FKBP52, p52, p59, peptidylprolyl cis-trans isomerase, peptidyl-prolyl cis-trans isomerase FKBP4, PPIase, PPIase FKBP4, Rotamase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FKBP4
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVE
• Quantity: 100 μL
• Research Discipline: Membrane Trafficking and Chaperones, Stem Cell Markers
• Gene ID (Entrez): 2288
• Target Species: Human
• Isotype: IgG

For Research Use Only