Learn More
Description
Specifications
Specifications
| Antigen | FKBP52/FKBP4 |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | 51 kDa FK506-binding protein, 52 kDa FKBP, 59 kDa immunophilin, EC 5.2.1.8, FK506 binding protein 4, 59kDa, FK506-binding protein 4, FK506-binding protein 4 (59kD), FKBP-4, FKBP51, FKBP-52, FKBP52T-cell FK506-binding protein, 59kD, FKBP5952 kDa FK506-binding protein, HBI, HSP binding immunophilin, Hsp56, HSP-binding immunophilin, Immunophilin FKBP52, p52, p59, peptidylprolyl cis-trans isomerase, peptidyl-prolyl cis-trans isomerase FKBP4, PPIase, PPIase FKBP4, Rotamase |
| Gene Symbols | FKBP4 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVE |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
