Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FKBP52/FKBP4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | FKBP52/FKBP4 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FKBP52/FKBP4 Polyclonal specifically detects FKBP52/FKBP4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| FKBP52/FKBP4 | |
| Polyclonal | |
| Rabbit | |
| Membrane Trafficking and Chaperones, Stem Cell Markers | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 2288 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 51 kDa FK506-binding protein, 52 kDa FKBP, 59 kDa immunophilin, EC 5.2.1.8, FK506 binding protein 4, 59kDa, FK506-binding protein 4, FK506-binding protein 4 (59kD), FKBP-4, FKBP51, FKBP-52, FKBP52T-cell FK506-binding protein, 59kD, FKBP5952 kDa FK506-binding protein, HBI, HSP binding immunophilin, Hsp56, HSP-binding immunophilin, Immunophilin FKBP52, p52, p59, peptidylprolyl cis-trans isomerase, peptidyl-prolyl cis-trans isomerase FKBP4, PPIase, PPIase FKBP4, Rotamase | |
| FKBP4 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title