FKBPL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156433

Catalog No. NBP156433

Description

FKBPL Polyclonal specifically detects FKBPL in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FKBPL
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DIR1WISP39, FK506 binding protein like, FK506-binding protein like, NG7FK506-binding protein-like, WAF-1/CIP1 stabilizing protein 39, WISp39
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 63943
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UIM3
• Gene Symbols: FKBPL
• Immunogen: Synthetic peptides corresponding to FKBPL (FK506 binding protein like) The peptide sequence was selected from the N terminal of FKBPL)(50ug). Peptide sequence METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 90%.
• Target Species: Human, Equine
• Isotype: IgG