Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FKBPL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FKBPL |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FKBPL Polyclonal specifically detects FKBPL in Human samples. It is validated for Western Blot.Specifications
FKBPL | |
Polyclonal | |
Rabbit | |
Q9UIM3 | |
63943 | |
Synthetic peptides corresponding to FKBPL (FK506 binding protein like) The peptide sequence was selected from the N terminal of FKBPL)(50ug). Peptide sequence METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DIR1WISP39, FK506 binding protein like, FK506-binding protein like, NG7FK506-binding protein-like, WAF-1/CIP1 stabilizing protein 39, WISp39 | |
FKBPL | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title