Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FKRP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP169029
Description
FKRP Polyclonal specifically detects FKRP in Mouse samples. It is validated for Western Blot.Specifications
FKRP | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
EC 2.-, fukutin related protein, fukutin-related protein, LGMD2IFLJ12576, MDC1CMGC2991, MDDGA5, MDDGB5, MDDGC5 | |
Rabbit | |
55 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q8CG64 | |
FKRP | |
Synthetic peptides corresponding to Fkrp (fukutin related protein) The peptide sequence was selected from the C terminal of Fkrp. Peptide sequence LDHRQDVEFPEHFLQPLVPLPFAGFMAQAPNNYRRFLELKFGPGVIENPE. | |
Affinity purified | |
RUO | |
79147 | |
Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction