FLJ13946 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24679225UL

Catalog No. NB396322

Description

FLJ13946 Polyclonal antibody specifically detects FLJ13946 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: FLJ13946
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q8N4P2
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 92104
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Gene Alias: FLJ13946, FLJ77601, IFT70A, tetratricopeptide repeat domain 30A, tetratricopeptide repeat protein 30A, TPR repeat protein 30A
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified