Invitrogen™ FLT3LG Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579272

Catalog No. PIPA579272

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Brain Tissue, Rat Spleen Tissue, Rat Kidney Tissue, SMMC whole cell.

FLT3LG (Fms Related Tyrosine Kinase 3 Ligand) is a Protein Coding gene. Diseases associated with FLT3LG include Aplastic Anemia and Brain Cancer. Among its related pathways are Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers and Ras signaling pathway. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and cytokine activity. Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8-positive classical DCs and their CD103-positive tissue counterparts.

Specifications

• Antigen: FLT3LG
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: FLT3LG
• Gene Alias: FL; Flt 3 ligand; Flt3; Flt3 L; Flt3 ligand; Flt3l; Flt3lg; fms related receptor tyrosine kinase 3 ligand; fms related tyrosine kinase 3 ligand; FMS-like tyrosine kinase 3 ligand; fms-related tyrosine kinase 3; fms-related tyrosine kinase 3 ligand; H-FLT-3-L; Ly72L; M-FLT-3-L; NEWGENE_2322792; SL cytokine
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 103691134, 2323
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P49771
• Gene Symbols: FLT3LG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Flt-3ligand (79-110aa AQRWMERLKTVAGSKMQGLLERVNTEIHFVTK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Product Type: Antibody
• Isotype: IgG