Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579272

Invitrogen™ FLT3LG Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579272
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579272 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579272 Supplier Invitrogen™ Supplier No. PA579272
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Brain Tissue, Rat Spleen Tissue, Rat Kidney Tissue, SMMC whole cell.

FLT3LG (Fms Related Tyrosine Kinase 3 Ligand) is a Protein Coding gene. Diseases associated with FLT3LG include Aplastic Anemia and Brain Cancer. Among its related pathways are Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers and Ras signaling pathway. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and cytokine activity. Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8-positive classical DCs and their CD103-positive tissue counterparts.
TRUSTED_SUSTAINABILITY

Specifications

Antigen FLT3LG
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene FLT3LG
Gene Accession No. P49771
Gene Alias FL; Flt 3 ligand; Flt3; Flt3 L; Flt3 ligand; Flt3l; Flt3lg; fms related receptor tyrosine kinase 3 ligand; fms related tyrosine kinase 3 ligand; FMS-like tyrosine kinase 3 ligand; fms-related tyrosine kinase 3; fms-related tyrosine kinase 3 ligand; H-FLT-3-L; Ly72L; M-FLT-3-L; NEWGENE_2322792; SL cytokine
Gene Symbols FLT3LG
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human Flt-3ligand (79-110aa AQRWMERLKTVAGSKMQGLLERVNTEIHFVTK).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 103691134, 2323
Target Species Human, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.