FOLR1 Rabbit anti-Human, Mouse, Rat, Clone: 3J6W3, Novus Biologicals™

Rabbit Monoclonal Antibody

Supplier:  Novus Biologicals NBP316069100UL

Catalog No. NB167233

Description

FOLR1 Monoclonal antibody specifically detects FOLR1 in Human, Mouse, Rat samples. It is validated for Western Blot

Specifications

• Antigen: FOLR1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot
• Clone: 3J6W3
• Dilution: Western Blot 1:500 - 1:2000
• Gene Alias: Adult folate-binding protein, FBP, folate binding protein, Folate receptor 1, folate receptor 1 (adult), folate receptor alpha, Folate receptor, adult, FOLR, FR-alpha, KB cells FBP, Ovarian tumor-associated antigen MOv18
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOLR1 (NP_000793.1). MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHF
• Quantity: 100 μg
• Research Discipline: Cancer
• Gene ID (Entrez): 2348
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG