Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FOLR4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19149620UL
Description
FOLR4 Polyclonal specifically detects FOLR4 in Human samples. It is validated for Western Blot.Specifications
FOLR4 | |
Polyclonal | |
Western Blot 1:1000 | |
folate receptor 4 (delta) homolog (mouse), Folbp3, probable folate receptor delta | |
Rabbit | |
28 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FOLR4 | |
Synthetic peptide directed towards the middle region of human FOLR4. Peptide sequence TCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKAS. | |
Affinity Purified | |
RUO | |
390243 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction