FoxC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB430963	Novus Biologicals NBP18902525UL	25 μL
NBP189025	Novus Biologicals NBP189025	0.1 mL

Description

FoxC1 Polyclonal specifically detects FoxC1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FoxC1
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: ARA, FKHL7RIEG3, forkhead box C1, forkhead box protein C1, forkhead, drosophila, homolog-like 7, forkhead/winged helix-like transcription factor 7, forkhead-related activator 3, Forkhead-related protein FKHL7, Forkhead-related transcription factor 3, FREAC-3, FREAC3IRID1, IGDA, IHG1, myeloid factor-delta
• Gene Symbols: FOXC1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cancer
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 2296
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only