Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FoxJ1/HFH4 Antibody, Novus Biologicals™
SDP

Catalog No. NB418428 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB418428 25 μL
NBP187928 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB418428 Supplier Novus Biologicals Supplier No. NBP18792825UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 3 publications

FoxJ1/HFH4 Polyclonal specifically detects FoxJ1/HFH4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Specifications

Antigen FoxJ1/HFH4
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Classification Polyclonal
Concentration 0.3mg/mL
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence Reported in scientific literature (PMID:35288560)., Immunohistochemistry-Paraffin 1:500 - 1:1000, Immunohistochemistry-Frozen Validated for IHC-Frozen from a verified customer review.
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias FKHL13forkhead transcription factor HFH-4, forkhead box J1, forkhead-like 13, Forkhead-related protein FKHL13, Hepatocyte nuclear factor 3 forkhead homolog 4, HFH4fork head homologue 4, HFH-4forkhead box protein J1, MGC35202
Gene Symbols FOXJ1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 2302
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.