Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FOXL2 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
SDP

Catalog No. NBP1690320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1690320 20 μL
NBP169031 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1690320 Supplier Novus Biologicals Supplier No. NBP16903120UL

Rabbit Polyclonal Antibody

FOXL2 Polyclonal antibody specifically detects Antigen in Rat samples. It is validated for Western Blotting.

Specifications

Antigen FOXL2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. D4A0S1
Gene Alias BPES, BPES1PINTO, forkhead box L2, forkhead box protein L2, forkhead transcription factor FOXL2, PFRK, POF3
Gene Symbols FOXL2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to Foxl2 (forkhead box L2) The peptide sequence was selected from the C terminal of Foxl2. Peptide sequence SPATAAPPAPAPTSAPGLQFACARQPELAMMHCSYWDHDSKTGALHSRLD.
Molecular Weight of Antigen 39 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 668
Target Species Rat
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.