Learn More
Description
Specifications
Specifications
| Antigen | FoxM1 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | FKHL16trident, forkhead box M1, forkhead box protein M1, Forkhead, drosophila, homolog-like 16, forkhead-like 16, Forkhead-related protein FKHL16, Hepatocyte nuclear factor 3 forkhead homolog 11, HFH11FOXM1B, HFH-11M-phase phosphoprotein 2, HNF-3, HNF-3/fork-head homolog 11, INS-1, MPHOSPH2, MPP-2, MPP2MPM-2 reactive phosphoprotein 2, PIG29, TGT3, Transcription factor Trident, TRIDENT, WIN, Winged-helix factor from INS-1 cells |
| Gene Symbols | FOXM1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGL |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
