Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FPR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP247452
Description
FPR1 Polyclonal specifically detects FPR1 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
FPR1 | |
Polyclonal | |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
fMet-Leu-Phe receptor, FMLP, fMLP receptor, formyl peptide receptor 1, FPRfMet-Leu-Phe receptor, N-formyl peptide receptor, N-formylpeptide chemoattractant receptor | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
FPR1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: TTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLT | |
0.1 mL | |
GPCR, Immunology, Protein Kinase | |
2357 | |
Human, Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction