Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FPR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

$393.50 - $673.00

Specifications

Antigen	FPR1
Dilution	Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP247452 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP247452	0.1 mL	Each for $673.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB396209 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP24745225UL	25 μL	Each for $393.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

FPR1 Polyclonal specifically detects FPR1 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	FPR1
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human, Mouse
Gene Alias	fMet-Leu-Phe receptor, FMLP, fMLP receptor, formyl peptide receptor 1, FPRfMet-Leu-Phe receptor, N-formyl peptide receptor, N-formylpeptide chemoattractant receptor
Gene Symbols	FPR1
Isotype	IgG
Purification Method	Affinity Purified

Dilution	Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	GPCR, Immunology, Protein Kinase
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	2357
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: TTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLT
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

FPR1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents