Frataxin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257717

Catalog No. NBP257717

Description

Frataxin Polyclonal specifically detects Frataxin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Frataxin
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: CyaY, EC 1.16.3.1, FA, FARRmitochondrial, frataxin, Friedreich ataxia, Friedreich ataxia protein, Fxn, X25MGC57199
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FXN
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDV
• Quantity: 100 μL
• Research Discipline: Diabetes Research
• Gene ID (Entrez): 2395
• Target Species: Human
• Isotype: IgG

For Research Use Only