Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FSCN3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$436.00
Specifications
| Antigen | FSCN3 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179542
|
Novus Biologicals
NBP179542 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
FSCN3 Polyclonal specifically detects FSCN3 in Human samples. It is validated for Western Blot, PCR.Specifications
| FSCN3 | |
| Unconjugated | |
| RUO | |
| NP_065102 | |
| 29999 | |
| Synthetic peptide directed towards the middle region of human FSCN3The immunogen for this antibody is FSCN3. Peptide sequence WGKFALNFCIELQGSNLLTVLAPNGFYMRADQSGTLLADSEDITRECIWE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| fascin (Strongylocentrotus purpuratus) homolog 3 (actin-bundling protein, fascin homolog 3, actin-bundling protein, testicular (Strongylocentrotuspurpuratus), fascin-3, testicular), Testis fascin | |
| FSCN3 | |
| IgG | |
| Affinity Purified | |
| 55 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title