FSD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP31010025UL

Catalog No. NB125102

Description

FSD1 Polyclonal specifically detects FSD1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FSD1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: fibronectin type 3 and SPRY domain containing 1, fibronectin type III and SPRY domain containing 1, fibronectin type III and SPRY domain-containing protein 1, GLFNDfibronectin type 3 and SPRY (spla, ryanodine) domain containing (withcoiled-coil motif) 1, MGC3213, Microtubule-associated protein GLFND, midline 1-related protein 1, MIR1MID1-related protein 1
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FSD1 (NP_077309.1). Peptide sequence SPARGTPSPKRMPSGRGGRDRFTAESYTVLGDTLIDGGEHYWEVRYEPDS
• Quantity: 25 μg
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 79187
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified