FSD1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18658325UL

Catalog No. NB431846

Description

FSD1L Polyclonal specifically detects FSD1L in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FSD1L
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: CCDC10MGC45564, Coiled-coil domain-containing protein 10, CSDUFD1, cystatin and DUF19 domain containing 1, fibronectin type III and SPRY domain containing 1-like, FSD1 C-terminal like, FSD1 N-terminal like, FSD1 N-terminal-like protein, FSD1CL, FSD1-like protein, FSD1NLcoiled-coil domain containing 10, MIR1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 83856
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: FSD1L
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MDSQKEALQRIISTLANKNDEIQNFIDTLHHTLKGVQENSSNILSELDEEFDSLYSILDEVKESMINCIKQEQA
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only