Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FSD1L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | FSD1L |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FSD1L Polyclonal specifically detects FSD1L in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| FSD1L | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CCDC10MGC45564, Coiled-coil domain-containing protein 10, CSDUFD1, cystatin and DUF19 domain containing 1, fibronectin type III and SPRY domain containing 1-like, FSD1 C-terminal like, FSD1 N-terminal like, FSD1 N-terminal-like protein, FSD1CL, FSD1-like protein, FSD1NLcoiled-coil domain containing 10, MIR1 | |
| FSD1L | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 83856 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MDSQKEALQRIISTLANKNDEIQNFIDTLHHTLKGVQENSSNILSELDEEFDSLYSILDEVKESMINCIKQEQA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title