FSH beta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25772325UL

Catalog No. NB403393

Description

FSH beta Polyclonal specifically detects FSH beta in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FSH beta
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: follicle stimulating hormone, beta polypeptide, Follicle-stimulating hormone beta subunit, Follitropin beta chain, follitropin subunit beta, follitropin, beta chain, FSH-B, FSH-beta
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: FSHB
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGK
• Quantity: 25 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 2488
• Target Species: Human
• Isotype: IgG

For Research Use Only