FSIP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156460

Catalog No. NBP156460

Description

FSIP1 Polyclonal specifically detects FSIP1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FSIP1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: fibrous sheath interacting protein 1, fibrous sheath-interacting protein 1, FLJ35989
• Host Species: Rabbit
• Molecular Weight of Antigen: 66 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Canine: 92%; Guinea pig: 92%; Equine: 92%; Pig: 85%; Rabbit: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8NA03
• Gene Symbols: FSIP1
• Immunogen: Synthetic peptides corresponding to FSIP1(fibrous sheath interacting protein 1) The peptide sequence was selected from the middle region of FSIP1 (NP_689810). Peptide sequence DEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPT.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 161835
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.