Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FSIP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FSIP1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FSIP1 Polyclonal specifically detects FSIP1 in Human samples. It is validated for Western Blot.Specifications
FSIP1 | |
Polyclonal | |
Rabbit | |
Q8NA03 | |
161835 | |
Synthetic peptides corresponding to FSIP1(fibrous sheath interacting protein 1) The peptide sequence was selected from the middle region of FSIP1 (NP_689810). Peptide sequence DEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
fibrous sheath interacting protein 1, fibrous sheath-interacting protein 1, FLJ35989 | |
FSIP1 | |
IgG | |
66 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title