FTO Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25894125UL

Catalog No. NB403082

Description

FTO Polyclonal specifically detects FTO in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FTO
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: alpha-ketoglutarate-dependent dioxygenase FTO, EC 1.14.11.-, fat mass and obesity associated, Fat mass and obesity-associated protein, KIAA1752protein fto, MGC5149
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FTO
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMP
• Quantity: 25 μL
• Research Discipline: Lipid and Metabolism, Neuroscience
• Gene ID (Entrez): 79068
• Target Species: Human
• Form: Purified

For Research Use Only