FTO Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169021

Catalog No. NBP169021

Description

FTO Polyclonal specifically detects FTO in Mouse samples. It is validated for Western Blot, Immunoprecipitation.

Specifications

• Antigen: FTO
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunoprecipitation
• Gene Accession No.: Q8BGW1
• Gene Symbols: FTO
• Immunogen: Synthetic peptides corresponding to Fto (fat mass and obesity associated) The peptide sequence was selected from the N terminal of Fto. Peptide sequence MKRVQTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLV.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79068
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit, Sheep, Yeast
• Isotype: IgG

• Applications: Western Blot, Immunoprecipitation
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: alpha-ketoglutarate-dependent dioxygenase FTO, EC 1.14.11.-, fat mass and obesity associated, Fat mass and obesity-associated protein, KIAA1752protein fto, MGC5149
• Host Species: Rabbit
• Molecular Weight of Antigen: 58 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

For Research Use Only