Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FTO Antibody, Novus Biologicals™
SDP

Catalog No. NBP169021 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP169021 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP169021 Supplier Novus Biologicals Supplier No. NBP169021

Rabbit Polyclonal Antibody

FTO Polyclonal specifically detects FTO in Mouse samples. It is validated for Western Blot, Immunoprecipitation.

Specifications

Antigen FTO
Applications Western Blot, Immunoprecipitation
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunoprecipitation
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8BGW1
Gene Alias alpha-ketoglutarate-dependent dioxygenase FTO, EC 1.14.11.-, fat mass and obesity associated, Fat mass and obesity-associated protein, KIAA1752protein fto, MGC5149
Gene Symbols FTO
Host Species Rabbit
Immunogen Synthetic peptides corresponding to Fto (fat mass and obesity associated) The peptide sequence was selected from the N terminal of Fto. Peptide sequence MKRVQTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLV.
Molecular Weight of Antigen 58 kDa
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 79068
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit, Sheep, Yeast
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.