Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FTSJ3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17929620UL
Description
FTSJ3 Polyclonal specifically detects FTSJ3 in Rat samples. It is validated for Western Blot.Specifications
FTSJ3 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_001012014 | |
FTSJ3 | |
Synthetic peptide directed towards the C terminal of human Ftsj3The immunogen for this antibody is Ftsj3. Peptide sequence QVTYVVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQRKEQKRNHRRK. | |
20 μL | |
Primary | |
Rat | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EC 2.1.1, EC 2.1.1.-, EPCS3, FLJ20062, FtsJ homolog 3 (E. coli), Protein ftsJ homolog 3, putative rRNA methyltransferase 3, rRNA (uridine-2'-O-)-methyltransferase 3 | |
Rabbit | |
Affinity Purified | |
RUO | |
117246 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction