Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FTSJ3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
| Antigen | FTSJ3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17929620
|
Novus Biologicals
NBP17929620UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179296
|
Novus Biologicals
NBP179296 |
100 μL |
Each for $499.50
|
|
|||||
Description
FTSJ3 Polyclonal specifically detects FTSJ3 in Rat samples. It is validated for Western Blot.Specifications
| FTSJ3 | |
| Polyclonal | |
| Rabbit | |
| NP_001012014 | |
| 117246 | |
| Synthetic peptide directed towards the C terminal of human Ftsj3The immunogen for this antibody is Ftsj3. Peptide sequence QVTYVVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQRKEQKRNHRRK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.1.1, EC 2.1.1.-, EPCS3, FLJ20062, FtsJ homolog 3 (E. coli), Protein ftsJ homolog 3, putative rRNA methyltransferase 3, rRNA (uridine-2'-O-)-methyltransferase 3 | |
| FTSJ3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title