Fucosyltransferase 3/FUT3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP254732

Catalog No. NBP254732

Description

Fucosyltransferase 3/FUT3 Polyclonal specifically detects Fucosyltransferase 3/FUT3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Blood Group Lewis b
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: alpha-(1,3/1,4)-fucosyltransferase, Blood group Lewis alpha-4-fucosyltransferase, CD174, EC 2.4.1, EC 2.4.1.65, FT3B, Fucosyltransferase 3, fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group), Fucosyltransferase III, FucT-III, galactoside 3(4)-L-fucosyltransferase, LEfucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood groupincluded), Les, Lewis FT, MGC131739
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2525
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FUT3
• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:KDLARYLQELDKDHARYLSYFRWRETLRPRSFSWAL
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only