Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Fucosyltransferase 8/FUT8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179869
Description
Fucosyltransferase 8/FUT8 Polyclonal specifically detects Fucosyltransferase 8/FUT8 in Human samples. It is validated for Western Blot.Specifications
Fucosyltransferase 8/FUT8 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
alpha-(1,6)-fucosyltransferase, alpha1-6FucT, EC 2.4.1.68, Fucosyltransferase 8, fucosyltransferase 8 (alpha (1,6) fucosyltransferase), GDP-fucose--glycoprotein fucosyltransferase, GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase, Glycoprotein 6-alpha-L-fucosyltransferase, MGC26465 | |
Rabbit | |
47 kDa | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Zebrafish: 85%. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_004471 | |
FUT8 | |
The immunogen for this antibody is FUT8. Peptide sequence LVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQR. | |
Affinity purified | |
RUO | |
2530 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction